PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000805075
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 326aa    MW: 36488.7 Da    PI: 6.8435
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000805075genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +++++G+g+W++++   g+ R+ k+c++rw +yl
    MDP0000805075 14 KGPWTPEEDIVLVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding45.81.4e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
    MDP0000805075  67 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.68965IPR017930Myb domain
SuperFamilySSF466891.54E-3011108IPR009057Homeodomain-like
SMARTSM007171.8E-131363IPR001005SANT/Myb domain
PfamPF002491.7E-151461IPR001005SANT/Myb domain
CDDcd001671.62E-101661No hitNo description
Gene3DG3DSA:1.10.10.608.9E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129418.7566116IPR017930Myb domain
SMARTSM007173.5E-1366114IPR001005SANT/Myb domain
PfamPF002495.6E-1367112IPR001005SANT/Myb domain
CDDcd001674.05E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MGRPPCCEKV GIKKGPWTPE EDIVLVSYIQ EHGPGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIASYLPQRT DNDIKNYWNT HLKKKLKPFQ  120
SALDPHTTSN DPFNVNVSRR SLSEGSLDNM TSHASSIILR NNQSSSSTYA SSTENISRLL  180
EGWMRSSPTP KTSSLKYNAA SDDDQEKPSG TSTGNLVSNE EFESILSYEN LNNVASWDMY  240
TCDSSTYSNK VSQLSIKVPN GAEIIHDHHL LRDEDQKNKQ IIRCESSSTN CNNPPLTYLE  300
KWLLDESAGH VEADQMVELS PMSLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008386907.10.0PREDICTED: myb-related protein 306
TrEMBLM5VUV41e-177M5VUV4_PRUPE; Uncharacterized protein
STRINGPOPTR_0013s06390.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82033145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.15e-95myb domain protein 60